Lineage for d4fvla2 (4fvl A:276-471)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807265Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 2807266Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 2807301Family b.66.1.0: automated matches [196610] (1 protein)
    not a true family
  6. 2807302Protein automated matches [196611] (2 species)
    not a true protein
  7. 2807303Species Human (Homo sapiens) [TaxId:9606] [196612] (9 PDB entries)
  8. 2807307Domain d4fvla2: 4fvl A:276-471 [266272]
    Other proteins in same PDB: d4fvla1, d4fvlb1
    automated match to d3ba0a2
    complexed with ca, cl, gol, peg, pgo, zn

Details for d4fvla2

PDB Entry: 4fvl (more details), 2.44 Å

PDB Description: Human collagenase 3 (MMP-13) full form with peptides from pro-domain
PDB Compounds: (A:) collagenase 3

SCOPe Domain Sequences for d4fvla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fvla2 b.66.1.0 (A:276-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khpktpdkcdpslsldaitslrgetmifkdrffwrlhpqqvdaelfltksfwpelpnrid
aayehpshdlififrgrkfwalngydilegypkkiselglpkevkkisaavhfedtgktl
lfsgnqvwryddtnhimdkdyprlieedfpgigdkvdavyekngyiyffngpiqfeysiw
snrivrvmpansilwc

SCOPe Domain Coordinates for d4fvla2:

Click to download the PDB-style file with coordinates for d4fvla2.
(The format of our PDB-style files is described here.)

Timeline for d4fvla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fvla1