Lineage for d4fvla1 (4fvl A:104-275)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205558Protein Collagenase-3 (MMP-13) [55540] (2 species)
  7. 2205559Species Human (Homo sapiens) [TaxId:9606] [55541] (45 PDB entries)
  8. 2205646Domain d4fvla1: 4fvl A:104-275 [266271]
    Other proteins in same PDB: d4fvla2, d4fvlb2
    automated match to d3ba0a1
    complexed with ca, cl, gol, peg, pgo, zn

Details for d4fvla1

PDB Entry: 4fvl (more details), 2.44 Å

PDB Description: Human collagenase 3 (MMP-13) full form with peptides from pro-domain
PDB Compounds: (A:) collagenase 3

SCOPe Domain Sequences for d4fvla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fvla1 d.92.1.11 (A:104-275) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]}
ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi
misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha
fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnp

SCOPe Domain Coordinates for d4fvla1:

Click to download the PDB-style file with coordinates for d4fvla1.
(The format of our PDB-style files is described here.)

Timeline for d4fvla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fvla2