Lineage for d4fu4b2 (4fu4 B:276-471)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416783Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 2416784Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 2416819Family b.66.1.0: automated matches [196610] (1 protein)
    not a true family
  6. 2416820Protein automated matches [196611] (2 species)
    not a true protein
  7. 2416821Species Human (Homo sapiens) [TaxId:9606] [196612] (9 PDB entries)
  8. 2416832Domain d4fu4b2: 4fu4 B:276-471 [266270]
    Other proteins in same PDB: d4fu4a1, d4fu4b1
    automated match to d3ba0a2
    complexed with ca, cl, edo, zn

Details for d4fu4b2

PDB Entry: 4fu4 (more details), 2.85 Å

PDB Description: Human collagenase 3 (MMP-13) with peptide from pro-domain
PDB Compounds: (B:) collagenase 3

SCOPe Domain Sequences for d4fu4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fu4b2 b.66.1.0 (B:276-471) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khpktpdkcdpslsldaitslrgetmifkdrffwrlhpqqvdaelfltksfwpelpnrid
aayehpshdlififrgrkfwalngydilegypkkiselglpkevkkisaavhfedtgktl
lfsgnqvwryddtnhimdkdyprlieedfpgigdkvdavyekngyiyffngpiqfeysiw
snrivrvmpansilwc

SCOPe Domain Coordinates for d4fu4b2:

Click to download the PDB-style file with coordinates for d4fu4b2.
(The format of our PDB-style files is described here.)

Timeline for d4fu4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fu4b1