Lineage for d4flcb_ (4flc B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010440Species Human (Homo sapiens) [TaxId:9606] [256256] (5 PDB entries)
  8. 2010452Domain d4flcb_: 4flc B: [266264]
    automated match to d4ffxc_
    mutant

Details for d4flcb_

PDB Entry: 4flc (more details), 2.6 Å

PDB Description: Structural and Biochemical Characterization of Human Adenylosuccinate Lyase (ADSL) and the R303C ADSL Deficiency Associated Mutation
PDB Compounds: (B:) adenylosuccinate lyase

SCOPe Domain Sequences for d4flcb_:

Sequence, based on SEQRES records: (download)

>d4flcb_ a.127.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqire
mksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliil
rnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlq
nlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtyt
rkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrnpmrsecc
cslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvv
ypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndli
eriqvdayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyes

Sequence, based on observed residues (ATOM records): (download)

>d4flcb_ a.127.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqire
mksnlenidfkmaaeeekrlrhdvmahvhtfghccaagiihlgatscyvgdntdliilrn
aldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlqnl
krvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtytrk
vdievlsvlaslgasvhkictdirllanlkemeepfekqqampykrnpmrsecccslarh
lmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvie
rrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqvd
ayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyes

SCOPe Domain Coordinates for d4flcb_:

Click to download the PDB-style file with coordinates for d4flcb_.
(The format of our PDB-style files is described here.)

Timeline for d4flcb_: