Lineage for d4fkmb_ (4fkm B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912839Species Staphylococcus aureus [TaxId:1280] [267935] (3 PDB entries)
  8. 2912842Domain d4fkmb_: 4fkm B: [266260]
    automated match to d3g9qa_

Details for d4fkmb_

PDB Entry: 4fkm (more details), 2.2 Å

PDB Description: Structure of unliganded and reductively methylated FhuD2 from staphylococcus aureus
PDB Compounds: (B:) Similar to ferric hydroxamate receptor 1

SCOPe Domain Sequences for d4fkmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fkmb_ c.92.2.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
dpkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvakekpd
liivystdkdikkyqkvaptvvvdynkhkyleqqemlgkivgkedkvkawkkdweettak
dgkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqkltakagw
aevkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyndpyt
ldfmrkdlkeklikaak

SCOPe Domain Coordinates for d4fkmb_:

Click to download the PDB-style file with coordinates for d4fkmb_.
(The format of our PDB-style files is described here.)

Timeline for d4fkmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4fkma_