SCOPe 2.05: Domain d4filc_: 4fil C:

Lineage for d4filc_ (4fil C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (28 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [267935] (2 PDB entries)

8. Domain d4filc_: 4fil C: [266257]
   automated match to d3g9qa_
   complexed with 0ue, edo, zn

Details for d4filc_

PDB Entry: 4fil, 2.4 Å

PDB Description: Structure of FhuD2 from Staphylococcus Aureus with Bound Ferrioxamine B

PDB Compounds: (C:) Ferric hydroxamate receptor 2

SCOPe Domain Sequences for d4filc_:

Sequence; same for both SEQRES and ATOM records:

>d4filc_ c.92.2.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
pkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvakekpdl
iivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdweettakd
gkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqkltakagwa
evkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyndpytl
dfmrkdlkeklikaak

Timeline for d4filc_:

• d4filc_ is new in SCOPe 2.05-stable
  
• d4filc_ appears in SCOPe 2.06
  
• d4filc_ appears in the current release, SCOPe 2.08