Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (40 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [267935] (3 PDB entries) |
Domain d4filb_: 4fil B: [266256] automated match to d3g9qa_ complexed with 0ue, edo, zn |
PDB Entry: 4fil (more details), 2.4 Å
SCOPe Domain Sequences for d4filb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4filb_ c.92.2.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} pkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvakekpdl iivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdweettakd gkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqkltakagwa evkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyndpytl dfmrkdlkeklikaak
Timeline for d4filb_: