Lineage for d4fila_ (4fil A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912839Species Staphylococcus aureus [TaxId:1280] [267935] (3 PDB entries)
  8. 2912843Domain d4fila_: 4fil A: [266255]
    automated match to d3g9qa_
    complexed with 0ue, edo, zn

Details for d4fila_

PDB Entry: 4fil (more details), 2.4 Å

PDB Description: Structure of FhuD2 from Staphylococcus Aureus with Bound Ferrioxamine B
PDB Compounds: (A:) Ferric hydroxamate receptor 2

SCOPe Domain Sequences for d4fila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fila_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
pkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvakekpdl
iivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdweettakd
gkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqkltakagwa
evkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyndpytl
dfmrkdlkeklikaak

SCOPe Domain Coordinates for d4fila_:

Click to download the PDB-style file with coordinates for d4fila_.
(The format of our PDB-style files is described here.)

Timeline for d4fila_: