Lineage for d4ffka2 (4ffk A:106-223)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946314Species Acidilobus saccharovorans [TaxId:666510] [267932] (1 PDB entry)
  8. 2946315Domain d4ffka2: 4ffk A:106-223 [266248]
    Other proteins in same PDB: d4ffka1, d4ffka3
    automated match to d1p7ga2
    complexed with fe

Details for d4ffka2

PDB Entry: 4ffk (more details), 1.76 Å

PDB Description: x-ray structure of iron superoxide dismutase from acidilobus saccharovorans
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4ffka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ffka2 d.44.1.0 (A:106-223) automated matches {Acidilobus saccharovorans [TaxId: 666510]}
ggtpggaigdainkffgsfdkfkklfgdaaknvegvgwailaydpvtgdlrilqvekhnn
vvttnlipllavdvfehayyidyrndrakyvdswwdlinwddvearyqkalntpklil

SCOPe Domain Coordinates for d4ffka2:

Click to download the PDB-style file with coordinates for d4ffka2.
(The format of our PDB-style files is described here.)

Timeline for d4ffka2: