Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Acidilobus saccharovorans [TaxId:666510] [267932] (1 PDB entry) |
Domain d4ffka2: 4ffk A:106-223 [266248] Other proteins in same PDB: d4ffka1, d4ffka3 automated match to d1p7ga2 complexed with fe |
PDB Entry: 4ffk (more details), 1.76 Å
SCOPe Domain Sequences for d4ffka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ffka2 d.44.1.0 (A:106-223) automated matches {Acidilobus saccharovorans [TaxId: 666510]} ggtpggaigdainkffgsfdkfkklfgdaaknvegvgwailaydpvtgdlrilqvekhnn vvttnlipllavdvfehayyidyrndrakyvdswwdlinwddvearyqkalntpklil
Timeline for d4ffka2: