| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries) |
| Domain d4f0bb2: 4f0b B:101-224 [266244] Other proteins in same PDB: d4f0ba1, d4f0bb1 automated match to d4ivfd2 complexed with gds, gol |
PDB Entry: 4f0b (more details), 1.45 Å
SCOPe Domain Sequences for d4f0bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0bb2 a.45.1.0 (B:101-224) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
fsrdpvkdpkgyseelqwlffahggigpmqgqanhfnlyapekipyainrylneskrlyr
vlddrlkgreyilgtygiadikifgwariaprtgldldefpnvkawveriekrpavqagi
nscn
Timeline for d4f0bb2: