![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) ![]() contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily |
![]() | Family d.58.58.0: automated matches [191564] (1 protein) not a true family |
![]() | Protein automated matches [190980] (6 species) not a true protein |
![]() | Species Bacillus halodurans [TaxId:272558] [267929] (3 PDB entries) |
![]() | Domain d4es3a1: 4es3 A:1-86 [266239] Other proteins in same PDB: d4es3a2 automated match to d4qr0a_ complexed with edo |
PDB Entry: 4es3 (more details), 1.7 Å
SCOPe Domain Sequences for d4es3a1:
Sequence, based on SEQRES records: (download)
>d4es3a1 d.58.58.0 (A:1-86) automated matches {Bacillus halodurans [TaxId: 272558]} mlvlitydvqtssmggtkrlrkvakacqnygqrvqnsvfecivdstqltslkleltslid eekdslriyrlgnnyktkvehigakp
>d4es3a1 d.58.58.0 (A:1-86) automated matches {Bacillus halodurans [TaxId: 272558]} mlvlitydvqtssmggtkrlrkvakacqnygqrvqnsvfecivdstqltslkleltslid eekdslriyrlnykvehigakp
Timeline for d4es3a1: