SCOPe 2.08: Domain d4es3a1: 4es3 A:1-86

Lineage for d4es3a1 (4es3 A:1-86)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families)
   contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily

5. Family d.58.58.0: automated matches [191564] (1 protein)
   not a true family

6. Protein automated matches [190980] (6 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [267929] (3 PDB entries)

8. Domain d4es3a1: 4es3 A:1-86 [266239]
   Other proteins in same PDB: d4es3a2
   automated match to d4qr0a_
   complexed with edo

Details for d4es3a1

PDB Entry: 4es3, 1.7 Å

PDB Description: double-stranded endonuclease activity in b. halodurans clustered regularly interspaced short palindromic repeats (crispr)-associated cas2 protein

PDB Compounds: (A:) BH0342 protein

SCOPe Domain Sequences for d4es3a1:

Sequence, based on SEQRES records:

>d4es3a1 d.58.58.0 (A:1-86) automated matches {Bacillus halodurans [TaxId: 272558]}
mlvlitydvqtssmggtkrlrkvakacqnygqrvqnsvfecivdstqltslkleltslid
eekdslriyrlgnnyktkvehigakp

Sequence, based on observed residues (ATOM records):

>d4es3a1 d.58.58.0 (A:1-86) automated matches {Bacillus halodurans [TaxId: 272558]}
mlvlitydvqtssmggtkrlrkvakacqnygqrvqnsvfecivdstqltslkleltslid
eekdslriyrlnykvehigakp

Timeline for d4es3a1:

• d4es3a1 first appeared in SCOPe 2.05, called d4es3a_
  
• d4es3a1 appears in SCOPe 2.07