| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) ![]() contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily |
| Family d.58.58.0: automated matches [191564] (1 protein) not a true family |
| Protein automated matches [190980] (6 species) not a true protein |
| Species Bacillus halodurans [TaxId:272558] [267929] (3 PDB entries) |
| Domain d4es2a1: 4es2 A:1-87 [266238] Other proteins in same PDB: d4es2a2 automated match to d4qr0a_ |
PDB Entry: 4es2 (more details), 1.3 Å
SCOPe Domain Sequences for d4es2a1:
Sequence, based on SEQRES records: (download)
>d4es2a1 d.58.58.0 (A:1-87) automated matches {Bacillus halodurans [TaxId: 272558]}
mlvlitydvqtssmggtkrlrkvakacqnygqrvqnsvfecivdstqltslkleltslid
eekdslriyrlgnnyktkvehigakps
>d4es2a1 d.58.58.0 (A:1-87) automated matches {Bacillus halodurans [TaxId: 272558]}
mlvlitydvqsmggtkrlrkvakacqnygqrvqnsvfecivdstqltslkleltslidee
kdslriyrlgytkvehigakps
Timeline for d4es2a1: