Lineage for d4es2a1 (4es2 A:1-87)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562976Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. 2563002Family d.58.58.0: automated matches [191564] (1 protein)
    not a true family
  6. 2563003Protein automated matches [190980] (6 species)
    not a true protein
  7. 2563004Species Bacillus halodurans [TaxId:272558] [267929] (3 PDB entries)
  8. 2563006Domain d4es2a1: 4es2 A:1-87 [266238]
    Other proteins in same PDB: d4es2a2
    automated match to d4qr0a_

Details for d4es2a1

PDB Entry: 4es2 (more details), 1.3 Å

PDB Description: double-stranded endonuclease activity in b. halodurans clustered regularly interspaced short palindromic repeats (crispr)-associated cas2 protein
PDB Compounds: (A:) BH0342 protein

SCOPe Domain Sequences for d4es2a1:

Sequence, based on SEQRES records: (download)

>d4es2a1 d.58.58.0 (A:1-87) automated matches {Bacillus halodurans [TaxId: 272558]}
mlvlitydvqtssmggtkrlrkvakacqnygqrvqnsvfecivdstqltslkleltslid
eekdslriyrlgnnyktkvehigakps

Sequence, based on observed residues (ATOM records): (download)

>d4es2a1 d.58.58.0 (A:1-87) automated matches {Bacillus halodurans [TaxId: 272558]}
mlvlitydvqsmggtkrlrkvakacqnygqrvqnsvfecivdstqltslkleltslidee
kdslriyrlgytkvehigakps

SCOPe Domain Coordinates for d4es2a1:

Click to download the PDB-style file with coordinates for d4es2a1.
(The format of our PDB-style files is described here.)

Timeline for d4es2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4es2a2