SCOPe 2.08: Domain d4eq3a2: 4eq3 A:101-207

Lineage for d4eq3a2 (4eq3 A:101-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [267928] (2 PDB entries)

8. Domain d4eq3a2: 4eq3 A:101-207 [266236]
   automated match to d1fg9d2

Details for d4eq3a2

PDB Entry: 4eq3, 2 Å

PDB Description: Crystal Structure Analysis of Selenomethionine (Se-Met) Substituted Chicken Interferon Gamma Receptor Alpha Chain

PDB Compounds: (A:) Interferon gamma receptor 1

SCOPe Domain Sequences for d4eq3a2:

Sequence; same for both SEQRES and ATOM records:

>d4eq3a2 b.1.2.0 (A:101-207) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
igppklnlsrhgaeiivdvyhpefpsvevrpwmreiyselsysvifrnsenesrknftva
dcemnecnlsipvpsegstycvsakghffddlivgasseesciwvpi

Timeline for d4eq3a2:

• d4eq3a2 first appeared in SCOPe 2.05
  
• d4eq3a2 appears in SCOPe 2.07