Lineage for d4eq2a2 (4eq2 A:101-207)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2372249Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2372250Protein automated matches [190976] (5 species)
    not a true protein
  7. 2372267Species Chicken (Gallus gallus) [TaxId:9031] [267928] (2 PDB entries)
  8. 2372271Domain d4eq2a2: 4eq2 A:101-207 [266234]
    automated match to d1fg9d2

Details for d4eq2a2

PDB Entry: 4eq2 (more details), 2.5 Å

PDB Description: Crystal Structure Analysis of Chicken Interferon Gamma Receptor Alpha Chain
PDB Compounds: (A:) Interferon gamma receptor 1

SCOPe Domain Sequences for d4eq2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eq2a2 b.1.2.0 (A:101-207) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
igppklnlsrhgaeiivdvyhpefpsvevrpwmreiyselsysvifrnsenesrknftva
dcemnecnlsipvpsegstycvsakghffddlivgasseesciwvpi

SCOPe Domain Coordinates for d4eq2a2:

Click to download the PDB-style file with coordinates for d4eq2a2.
(The format of our PDB-style files is described here.)

Timeline for d4eq2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4eq2a1