| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
| Protein automated matches [190976] (5 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [267928] (2 PDB entries) |
| Domain d4eq2a2: 4eq2 A:101-207 [266234] automated match to d1fg9d2 |
PDB Entry: 4eq2 (more details), 2.5 Å
SCOPe Domain Sequences for d4eq2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eq2a2 b.1.2.0 (A:101-207) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
igppklnlsrhgaeiivdvyhpefpsvevrpwmreiyselsysvifrnsenesrknftva
dcemnecnlsipvpsegstycvsakghffddlivgasseesciwvpi
Timeline for d4eq2a2: