![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
![]() | Protein automated matches [190976] (5 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [267928] (2 PDB entries) |
![]() | Domain d4eq2a1: 4eq2 A:2-100 [266233] automated match to d1fg9d1 |
PDB Entry: 4eq2 (more details), 2.5 Å
SCOPe Domain Sequences for d4eq2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eq2a1 b.1.2.0 (A:2-100) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} avpsptgtsvksknfrtvlywqypsmsetphfvvevkpylsgkyqtvstcvnisatscdl seeineifhsywfrikaivgsqqsqyvetdefvlqkhgk
Timeline for d4eq2a1: