| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) ![]() |
| Family c.43.1.0: automated matches [191456] (1 protein) not a true family |
| Protein automated matches [190703] (6 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [267774] (8 PDB entries) |
| Domain d4epha1: 4eph A:441-656 [266232] automated match to d1nm8a2 complexed with 0rk, bog |
PDB Entry: 4eph (more details), 2.3 Å
SCOPe Domain Sequences for d4epha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4epha1 c.43.1.0 (A:441-656) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrte
tirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalr
ylatarglnlpelyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddw
igcnvssysgrnareflhcvqkcledifdalegkai
Timeline for d4epha1: