Lineage for d4ep9a1 (4ep9 A:441-656)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130379Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2130380Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2130565Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 2130566Protein automated matches [190703] (6 species)
    not a true protein
  7. 2130614Species Norway rat (Rattus norvegicus) [TaxId:10116] [267774] (8 PDB entries)
  8. 2130623Domain d4ep9a1: 4ep9 A:441-656 [266231]
    automated match to d1nm8a2
    complexed with 0rd, plm

Details for d4ep9a1

PDB Entry: 4ep9 (more details), 2.03 Å

PDB Description: crystal structure of rat carnitine palmitoyltransferase 2 in complex with coa-site inhibitor
PDB Compounds: (A:) Carnitine O-palmitoyltransferase 2, mitochondrial

SCOPe Domain Sequences for d4ep9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ep9a1 c.43.1.0 (A:441-656) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrte
tirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalr
ylatarglnlpelyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddw
igcnvssysgrnareflhcvqkcledifdalegkai

SCOPe Domain Coordinates for d4ep9a1:

Click to download the PDB-style file with coordinates for d4ep9a1.
(The format of our PDB-style files is described here.)

Timeline for d4ep9a1: