![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) ![]() |
![]() | Family c.51.1.0: automated matches [227929] (1 protein) not a true family |
![]() | Protein automated matches [227930] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267893] (3 PDB entries) |
![]() | Domain d4eo4b2: 4eo4 B:341-462 [266226] Other proteins in same PDB: d4eo4a1, d4eo4b1, d4eo4c1, d4eo4d1 automated match to d4hwta2 protein/RNA complex; complexed with ssa, zn |
PDB Entry: 4eo4 (more details), 2.87 Å
SCOPe Domain Sequences for d4eo4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eo4b2 c.51.1.0 (B:341-462) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} wpfwlnpyqaviipvntknvqqldmctalqkklrneleaddmepvplndwhfnvdldirn epvgyriksailknysyliivgdeevqlqkynirerdnrksfekltmsqiwekfielekn yk
Timeline for d4eo4b2: