Lineage for d4eo4a1 (4eo4 A:36-340)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1921049Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1921050Protein automated matches [226887] (9 species)
    not a true protein
  7. 1921060Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267892] (3 PDB entries)
  8. 1921063Domain d4eo4a1: 4eo4 A:36-340 [266223]
    Other proteins in same PDB: d4eo4a2, d4eo4b2, d4eo4c2, d4eo4d2
    automated match to d4hwta1
    protein/RNA complex; complexed with ssa, zn

Details for d4eo4a1

PDB Entry: 4eo4 (more details), 2.87 Å

PDB Description: Crystal structure of the yeast mitochondrial threonyl-tRNA synthetase (MST1) in complex with seryl sulfamoyl adenylate
PDB Compounds: (A:) Threonine--tRNA ligase, mitochondrial

SCOPe Domain Sequences for d4eo4a1:

Sequence, based on SEQRES records: (download)

>d4eo4a1 d.104.1.0 (A:36-340) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
atmtsmvsqrqdlfmtdplspgsmfflpngakifnkliefmklqqkfkfgfnevvtpliy
kktlweksghwenyaddmfkvettdeekeeyglkpmncpghclifgkkdrsynelplrfs
dfsplhrneasgalsgltrlrkfhqddghifctpsqvkseifnslklidivynkifpfvk
ggsgaesnyfinfstrpdhfigdlkvwnhaeqvlkeileesgkpwklnpgdgafygpkld
imvtdhlrkthqvatiqldfqlperfdlkfkdqdnsykrpimihratfgsierfmallid
snegr

Sequence, based on observed residues (ATOM records): (download)

>d4eo4a1 d.104.1.0 (A:36-340) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
atmtsmvsqrqdlfmtdplspgsmfflpngakifnkliefmklqqkfkfgfnevvtpliy
kktlweksghwenyaddmfkvetkeeyglkpmncpghclifgkkdrsynelplrfsdfsp
lhrneasgalsgltrlrkfhqddghifctpsqvkseifnslklidivynkifpfaesnyf
infstrpdhfigdlkvwnhaeqvlkeileesgkpwklnpgdgafygpkldimvtdhlrkt
hqvatiqldfqlperfdlkfkdqdnsykrpimihratfgsierfmallidsnegr

SCOPe Domain Coordinates for d4eo4a1:

Click to download the PDB-style file with coordinates for d4eo4a1.
(The format of our PDB-style files is described here.)

Timeline for d4eo4a1: