Lineage for d4ei2l1 (4ei2 L:115-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845624Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
    automatically mapped to Pfam PF02254
  6. 2845674Protein automated matches [228498] (1 species)
    not a true protein
  7. 2845675Species Methanothermobacter thermautotrophicus [TaxId:187420] [228499] (8 PDB entries)
  8. 2845705Domain d4ei2l1: 4ei2 L:115-244 [266213]
    Other proteins in same PDB: d4ei2a2, d4ei2a3, d4ei2b2, d4ei2c2, d4ei2c3, d4ei2d2, d4ei2d3, d4ei2e2, d4ei2e3, d4ei2f2, d4ei2f3, d4ei2g2, d4ei2g3, d4ei2h2, d4ei2h3, d4ei2i2, d4ei2j2, d4ei2j3, d4ei2k2, d4ei2k3, d4ei2l2, d4ei2m2, d4ei2m3, d4ei2n2, d4ei2n3, d4ei2o2, d4ei2p2
    automated match to d2aema1
    complexed with ba

Details for d4ei2l1

PDB Entry: 4ei2 (more details), 3.11 Å

PDB Description: Crystal Structures of MthK RCK gating ring bound to Barium
PDB Compounds: (L:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4ei2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ei2l1 c.2.1.9 (L:115-244) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
srhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekan
vrgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvi
sgrlmsrsid

SCOPe Domain Coordinates for d4ei2l1:

Click to download the PDB-style file with coordinates for d4ei2l1.
(The format of our PDB-style files is described here.)

Timeline for d4ei2l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ei2l2