| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins) automatically mapped to Pfam PF02254 |
| Protein automated matches [228498] (1 species) not a true protein |
| Species Methanothermobacter thermautotrophicus [TaxId:187420] [228499] (8 PDB entries) |
| Domain d4ei2l1: 4ei2 L:115-244 [266213] Other proteins in same PDB: d4ei2a2, d4ei2a3, d4ei2b2, d4ei2c2, d4ei2c3, d4ei2d2, d4ei2d3, d4ei2e2, d4ei2e3, d4ei2f2, d4ei2f3, d4ei2g2, d4ei2g3, d4ei2h2, d4ei2h3, d4ei2i2, d4ei2j2, d4ei2j3, d4ei2k2, d4ei2k3, d4ei2l2, d4ei2m2, d4ei2m3, d4ei2n2, d4ei2n3, d4ei2o2, d4ei2p2 automated match to d2aema1 complexed with ba |
PDB Entry: 4ei2 (more details), 3.11 Å
SCOPe Domain Sequences for d4ei2l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ei2l1 c.2.1.9 (L:115-244) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
srhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekan
vrgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvi
sgrlmsrsid
Timeline for d4ei2l1:
View in 3DDomains from other chains: (mouse over for more information) d4ei2a1, d4ei2a2, d4ei2a3, d4ei2b1, d4ei2b2, d4ei2c1, d4ei2c2, d4ei2c3, d4ei2d1, d4ei2d2, d4ei2d3, d4ei2e1, d4ei2e2, d4ei2e3, d4ei2f1, d4ei2f2, d4ei2f3, d4ei2g1, d4ei2g2, d4ei2g3, d4ei2h1, d4ei2h2, d4ei2h3, d4ei2i1, d4ei2i2, d4ei2j1, d4ei2j2, d4ei2j3, d4ei2k1, d4ei2k2, d4ei2k3, d4ei2m1, d4ei2m2, d4ei2m3, d4ei2n1, d4ei2n2, d4ei2n3, d4ei2o1, d4ei2o2, d4ei2p1, d4ei2p2 |