SCOPe 2.08: Domain d4ei2i2: 4ei2 I:245-336

Lineage for d4ei2i2 (4ei2 I:245-336)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families)

5. Family d.286.1.0: automated matches [228502] (1 protein)
   not a true family

6. Protein automated matches [228504] (1 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries)

8. Domain d4ei2i2: 4ei2 I:245-336 [266208]
   Other proteins in same PDB: d4ei2a1, d4ei2a3, d4ei2b1, d4ei2c1, d4ei2c3, d4ei2d1, d4ei2d3, d4ei2e1, d4ei2e3, d4ei2f1, d4ei2f3, d4ei2g1, d4ei2g3, d4ei2h1, d4ei2h3, d4ei2i1, d4ei2j1, d4ei2j3, d4ei2k1, d4ei2k3, d4ei2l1, d4ei2m1, d4ei2m3, d4ei2n1, d4ei2n3, d4ei2o1, d4ei2p1
   automated match to d2aema2
   complexed with ba

Details for d4ei2i2

PDB Entry: 4ei2, 3.11 Å

PDB Description: Crystal Structures of MthK RCK gating ring bound to Barium

PDB Compounds: (I:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4ei2i2:

Sequence; same for both SEQRES and ATOM records:

>d4ei2i2 d.286.1.0 (I:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

Timeline for d4ei2i2:

• d4ei2i2 first appeared in SCOPe 2.05
  
• d4ei2i2 appears in SCOPe 2.07