SCOPe 2.05: Domain d4ei2i1: 4ei2 I:115-244

Lineage for d4ei2i1 (4ei2 I:115-244)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
   automatically mapped to Pfam PF02254

6. Protein automated matches [228498] (1 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [228499] (8 PDB entries)

8. Domain d4ei2i1: 4ei2 I:115-244 [266207]
   Other proteins in same PDB: d4ei2a2, d4ei2b2, d4ei2c2, d4ei2d2, d4ei2e2, d4ei2f2, d4ei2g2, d4ei2h2, d4ei2i2, d4ei2j2, d4ei2k2, d4ei2l2, d4ei2m2, d4ei2n2, d4ei2o2, d4ei2p2
   automated match to d2aema1
   complexed with ba

Details for d4ei2i1

PDB Entry: 4ei2, 3.11 Å

PDB Description: Crystal Structures of MthK RCK gating ring bound to Barium

PDB Compounds: (I:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4ei2i1:

Sequence; same for both SEQRES and ATOM records:

>d4ei2i1 c.2.1.9 (I:115-244) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
srhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekan
vrgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvi
sgrlmsrsid

Timeline for d4ei2i1:

• d4ei2i1 is new in SCOPe 2.05-stable
  
• d4ei2i1 appears in SCOPe 2.06
  
• d4ei2i1 appears in the current release, SCOPe 2.08