Lineage for d1b6ka_ (1b6k A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1796118Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1796134Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1796358Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 1796842Domain d1b6ka_: 1b6k A: [26619]
    complexed with pi5, so4

Details for d1b6ka_

PDB Entry: 1b6k (more details), 1.85 Å

PDB Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 5
PDB Compounds: (A:) retropepsin

SCOPe Domain Sequences for d1b6ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ka_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d1b6ka_:

Click to download the PDB-style file with coordinates for d1b6ka_.
(The format of our PDB-style files is described here.)

Timeline for d1b6ka_: