SCOPe 2.06: Domain d4eecb1: 4eec B:4-269

Lineage for d4eecb1 (4eec B:4-269)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Streptomyces toyocaensis [TaxId:55952] [267800] (4 PDB entries)

8. Domain d4eecb1: 4eec B:4-269 [266178]
   Other proteins in same PDB: d4eeca2, d4eecb2
   automated match to d3niba_
   complexed with a3p

Details for d4eecb1

PDB Entry: 4eec, 2.7 Å

PDB Description: crystal structure of the glycopeptide antibiotic sulfotransferase stal complexed with a3p and desulfo-a47934.

PDB Compounds: (B:) StaL

SCOPe Domain Sequences for d4eecb1:

Sequence, based on SEQRES records:

>d4eecb1 c.37.1.0 (B:4-269) automated matches {Streptomyces toyocaensis [TaxId: 55952]}
mcwiasypkagghwlrcmltsyvtgepvetwpgiqagvphlegllrdgeapsadpdeqvl
lathftadrpvlrfyrestakvvclirnprdamlslmrmkgippedveacrkiaetfiad
egfssvriwagegswpenirswtdsvhesfpnaavlavryedlrkdpegelwkvvdflel
ggrdgvadavanctlermremeerskllglettglmtrggkqlpfvgkggqrkslkfmgd
diekayadllhgetdfahyarlygya

Sequence, based on observed residues (ATOM records):

>d4eecb1 c.37.1.0 (B:4-269) automated matches {Streptomyces toyocaensis [TaxId: 55952]}
mcwiasypkagghwlrcmltsyvtgepvetwpgiqagvphlegllrdgeapsadpdeqvl
lathftadrpvlrfyrestakvvclirnprdamlslmrmkgippedveacrkiaetfiad
egfssvriwagegswpenirswtdsvhesfpnaavlavryedlrkdpegelwkvvdflel
ggrdgvadavanctlermremeerskkslkfmgddiekayadllhgetdfahyarlygya

Timeline for d4eecb1:

• d4eecb1 first appeared in SCOPe 2.05, called d4eecb_
  
• d4eecb1 appears in SCOPe 2.07
  
• d4eecb1 appears in the current release, SCOPe 2.08