Lineage for d4e4pa_ (4e4p A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084068Species Paenibacillus sp. [TaxId:324057] [193799] (3 PDB entries)
  8. 2084079Domain d4e4pa_: 4e4p A: [266175]
    automated match to d3emca_
    complexed with cl, mg

Details for d4e4pa_

PDB Entry: 4e4p (more details), 1.92 Å

PDB Description: second native structure of xylanase a1 from paenibacillus sp. jdr-2
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d4e4pa_:

Sequence, based on SEQRES records: (download)

>d4e4pa_ c.1.8.0 (A:) automated matches {Paenibacillus sp. [TaxId: 324057]}
aplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftftaa
damidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqtvmk
hfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevldenps
wniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnpdnv
klslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiarvtf
w

Sequence, based on observed residues (ATOM records): (download)

>d4e4pa_ c.1.8.0 (A:) automated matches {Paenibacillus sp. [TaxId: 324057]}
aplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftftaa
damidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqtvmk
hfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevldenps
wniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnpdnv
klslekfislgvevsvseldvtaglavgqaylyaqlfklykehadhiarvtfw

SCOPe Domain Coordinates for d4e4pa_:

Click to download the PDB-style file with coordinates for d4e4pa_.
(The format of our PDB-style files is described here.)

Timeline for d4e4pa_: