SCOPe 2.05: Domain d4e4fd1: 4e4f D:-2-111

Lineage for d4e4fd1 (4e4f D:-2-111)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Pectobacterium carotovorum [TaxId:561230] [267926] (1 PDB entry)

8. Domain d4e4fd1: 4e4f D:-2-111 [266173]
   Other proteins in same PDB: d4e4fa2, d4e4fb2, d4e4fc2, d4e4fd2
   automated match to d4il2a1
   complexed with cl, fmt, gol, mg

Details for d4e4fd1

PDB Entry: 4e4f, 2 Å

PDB Description: crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. carotovorum pc1

PDB Compounds: (D:) Mannonate dehydratase

SCOPe Domain Sequences for d4e4fd1:

Sequence; same for both SEQRES and ATOM records:

>d4e4fd1 d.54.1.0 (D:-2-111) automated matches {Pectobacterium carotovorum [TaxId: 561230]}
fqsmkivsaevfvtcpgrnfvtlkittdsgltglgdatlngrelpvasylndhvcpqlig
rdahqiediwqyfykgaywrrgpvtmsaisavdmalwdikakaanmplyqllgg

Timeline for d4e4fd1:

• d4e4fd1 is new in SCOPe 2.05-stable
  
• d4e4fd1 appears in SCOPe 2.06
  
• d4e4fd1 appears in the current release, SCOPe 2.08