Lineage for d4e4fc1 (4e4f C:1-111)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948423Species Pectobacterium carotovorum [TaxId:561230] [267926] (1 PDB entry)
  8. 2948426Domain d4e4fc1: 4e4f C:1-111 [266171]
    Other proteins in same PDB: d4e4fa2, d4e4fa3, d4e4fb2, d4e4fb3, d4e4fc2, d4e4fc3, d4e4fd2, d4e4fd3
    automated match to d4il2a1
    complexed with cl, fmt, gol, mg

Details for d4e4fc1

PDB Entry: 4e4f (more details), 2 Å

PDB Description: crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. carotovorum pc1
PDB Compounds: (C:) Mannonate dehydratase

SCOPe Domain Sequences for d4e4fc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4fc1 d.54.1.0 (C:1-111) automated matches {Pectobacterium carotovorum [TaxId: 561230]}
mkivsaevfvtcpgrnfvtlkittdsgltglgdatlngrelpvasylndhvcpqligrda
hqiediwqyfykgaywrrgpvtmsaisavdmalwdikakaanmplyqllgg

SCOPe Domain Coordinates for d4e4fc1:

Click to download the PDB-style file with coordinates for d4e4fc1.
(The format of our PDB-style files is described here.)

Timeline for d4e4fc1: