Lineage for d4e4fa2 (4e4f A:112-404)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445529Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2445723Protein automated matches [226997] (13 species)
    not a true protein
  7. 2445796Species Pectobacterium carotovorum [TaxId:561230] [267927] (1 PDB entry)
  8. 2445797Domain d4e4fa2: 4e4f A:112-404 [266168]
    Other proteins in same PDB: d4e4fa1, d4e4fa3, d4e4fb1, d4e4fb3, d4e4fc1, d4e4fc3, d4e4fd1, d4e4fd3
    automated match to d4il2a2
    complexed with cl, fmt, gol, mg

Details for d4e4fa2

PDB Entry: 4e4f (more details), 2 Å

PDB Description: crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. carotovorum pc1
PDB Compounds: (A:) Mannonate dehydratase

SCOPe Domain Sequences for d4e4fa2:

Sequence, based on SEQRES records: (download)

>d4e4fa2 c.1.11.2 (A:112-404) automated matches {Pectobacterium carotovorum [TaxId: 561230]}
asrtgvmvychttghsidevlddyakhrdqgfkairvqcgvpgmettygmakgkglayep
atkgslpeeqlwstekyldftpklfeavrdkfgfnehllhdmhhrltpieaarfgksved
yrlfwmedptpaenqacfrlirqhtvtpiavgevfnsiwdckqlieeqlidyirttitha
ggitgmrriadfaslyqvrtgshgpsdlspicmaaalhfdlwvpnfgvqeymgyseqmle
vfphswtfdngymhpgekpglgiefdeklaakypydpaylpvarledgtlwnw

Sequence, based on observed residues (ATOM records): (download)

>d4e4fa2 c.1.11.2 (A:112-404) automated matches {Pectobacterium carotovorum [TaxId: 561230]}
asrtgvmvychttghsidevlddyakhrdqgfkairvqcepatkgslpeeqlwstekyld
ftpklfeavrdkfgfnehllhdmhhrltpieaarfgksvedyrlfwmedptpaenqacfr
lirqhtvtpiavgevfnsiwdckqlieeqlidyirttithaggitgmrriadfaslyqvr
tgshgpsdlspicmaaalhfdlwvpnfgvqeymgyseqmlevfphswtfdngymhpgekp
glgiefdeklaakypydpaylpvarledgtlwnw

SCOPe Domain Coordinates for d4e4fa2:

Click to download the PDB-style file with coordinates for d4e4fa2.
(The format of our PDB-style files is described here.)

Timeline for d4e4fa2: