Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein automated matches [226997] (11 species) not a true protein |
Species Pectobacterium carotovorum [TaxId:561230] [267927] (1 PDB entry) |
Domain d4e4fa2: 4e4f A:112-404 [266168] Other proteins in same PDB: d4e4fa1, d4e4fb1, d4e4fc1, d4e4fd1 automated match to d4il2a2 complexed with cl, fmt, gol, mg |
PDB Entry: 4e4f (more details), 2 Å
SCOPe Domain Sequences for d4e4fa2:
Sequence, based on SEQRES records: (download)
>d4e4fa2 c.1.11.2 (A:112-404) automated matches {Pectobacterium carotovorum [TaxId: 561230]} asrtgvmvychttghsidevlddyakhrdqgfkairvqcgvpgmettygmakgkglayep atkgslpeeqlwstekyldftpklfeavrdkfgfnehllhdmhhrltpieaarfgksved yrlfwmedptpaenqacfrlirqhtvtpiavgevfnsiwdckqlieeqlidyirttitha ggitgmrriadfaslyqvrtgshgpsdlspicmaaalhfdlwvpnfgvqeymgyseqmle vfphswtfdngymhpgekpglgiefdeklaakypydpaylpvarledgtlwnw
>d4e4fa2 c.1.11.2 (A:112-404) automated matches {Pectobacterium carotovorum [TaxId: 561230]} asrtgvmvychttghsidevlddyakhrdqgfkairvqcepatkgslpeeqlwstekyld ftpklfeavrdkfgfnehllhdmhhrltpieaarfgksvedyrlfwmedptpaenqacfr lirqhtvtpiavgevfnsiwdckqlieeqlidyirttithaggitgmrriadfaslyqvr tgshgpsdlspicmaaalhfdlwvpnfgvqeymgyseqmlevfphswtfdngymhpgekp glgiefdeklaakypydpaylpvarledgtlwnw
Timeline for d4e4fa2: