SCOPe 2.05: Domain d4e4fa2: 4e4f A:112-404

Lineage for d4e4fa2 (4e4f A:112-404)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (11 species)
   not a true protein

7. Species Pectobacterium carotovorum [TaxId:561230] [267927] (1 PDB entry)

8. Domain d4e4fa2: 4e4f A:112-404 [266168]
   Other proteins in same PDB: d4e4fa1, d4e4fb1, d4e4fc1, d4e4fd1
   automated match to d4il2a2
   complexed with cl, fmt, gol, mg

Details for d4e4fa2

PDB Entry: 4e4f, 2 Å

PDB Description: crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. carotovorum pc1

PDB Compounds: (A:) Mannonate dehydratase

SCOPe Domain Sequences for d4e4fa2:

Sequence, based on SEQRES records:

>d4e4fa2 c.1.11.2 (A:112-404) automated matches {Pectobacterium carotovorum [TaxId: 561230]}
asrtgvmvychttghsidevlddyakhrdqgfkairvqcgvpgmettygmakgkglayep
atkgslpeeqlwstekyldftpklfeavrdkfgfnehllhdmhhrltpieaarfgksved
yrlfwmedptpaenqacfrlirqhtvtpiavgevfnsiwdckqlieeqlidyirttitha
ggitgmrriadfaslyqvrtgshgpsdlspicmaaalhfdlwvpnfgvqeymgyseqmle
vfphswtfdngymhpgekpglgiefdeklaakypydpaylpvarledgtlwnw

Sequence, based on observed residues (ATOM records):

>d4e4fa2 c.1.11.2 (A:112-404) automated matches {Pectobacterium carotovorum [TaxId: 561230]}
asrtgvmvychttghsidevlddyakhrdqgfkairvqcepatkgslpeeqlwstekyld
ftpklfeavrdkfgfnehllhdmhhrltpieaarfgksvedyrlfwmedptpaenqacfr
lirqhtvtpiavgevfnsiwdckqlieeqlidyirttithaggitgmrriadfaslyqvr
tgshgpsdlspicmaaalhfdlwvpnfgvqeymgyseqmlevfphswtfdngymhpgekp
glgiefdeklaakypydpaylpvarledgtlwnw

Timeline for d4e4fa2:

• d4e4fa2 is new in SCOPe 2.05-stable
  
• d4e4fa2 appears in SCOPe 2.06
  
• d4e4fa2 appears in the current release, SCOPe 2.08