![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:28901] [267925] (1 PDB entry) |
![]() | Domain d4dz1a_: 4dz1 A: [266166] automated match to d4f3sa_ complexed with dal |
PDB Entry: 4dz1 (more details), 1.9 Å
SCOPe Domain Sequences for d4dz1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dz1a_ c.94.1.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]} ivegrtlnvavspasppmlfksadgklqgidlelfssycqsrhcklniteyawdgmlgav asgqadvafsgisitdkrkkvidfsepyyinsfylvsmanhkitlnnlnelnkysigypr gmaysdlikndlepkgyyslskvklyptynetmadlkngnldlafieepvyftfknkkkm piesryvfknvdqlgiafkkgspvrddfnlwlkeqgpqkisgivdswmk
Timeline for d4dz1a_: