Lineage for d4dz1a_ (4dz1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916107Species Salmonella enterica [TaxId:28901] [267925] (1 PDB entry)
  8. 2916108Domain d4dz1a_: 4dz1 A: [266166]
    automated match to d4f3sa_
    complexed with dal

Details for d4dz1a_

PDB Entry: 4dz1 (more details), 1.9 Å

PDB Description: Crystal structure of DalS, an ATP binding cassette transporter for D-alanine from Salmonella enterica
PDB Compounds: (A:) DalS D-Alanine transporter

SCOPe Domain Sequences for d4dz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dz1a_ c.94.1.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]}
ivegrtlnvavspasppmlfksadgklqgidlelfssycqsrhcklniteyawdgmlgav
asgqadvafsgisitdkrkkvidfsepyyinsfylvsmanhkitlnnlnelnkysigypr
gmaysdlikndlepkgyyslskvklyptynetmadlkngnldlafieepvyftfknkkkm
piesryvfknvdqlgiafkkgspvrddfnlwlkeqgpqkisgivdswmk

SCOPe Domain Coordinates for d4dz1a_:

Click to download the PDB-style file with coordinates for d4dz1a_.
(The format of our PDB-style files is described here.)

Timeline for d4dz1a_: