SCOPe 2.05: Domain d4dxga2: 4dxg A:100-200

Lineage for d4dxga2 (4dxg A:100-200)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [267924] (1 PDB entry)

8. Domain d4dxga2: 4dxg A:100-200 [266165]
   Other proteins in same PDB: d4dxga1
   automated match to d4rcob2
   complexed with cl, pin

Details for d4dxga2

PDB Entry: 4dxg, 2.5 Å

PDB Description: crystal structure of staphylococcal superantigen-like protein 4 complexed with sialyl lewis x

PDB Compounds: (A:) Staphylococcal enterotoxin-like toxin

SCOPe Domain Sequences for d4dxga2:

Sequence; same for both SEQRES and ATOM records:

>d4dxga2 d.15.6.0 (A:100-200) automated matches {Staphylococcus aureus [TaxId: 426430]}
kvdhkagvritkednkgtishdvsefkitkeqislkeldfklrkqlieknnlygnvgsgk
ivikmknggkytfelhkklqenrmadvidgtnidnievnik

Timeline for d4dxga2:

• d4dxga2 is new in SCOPe 2.05-stable
  
• d4dxga2 appears in SCOPe 2.06
  
• d4dxga2 appears in the current release, SCOPe 2.08