Lineage for d4dxfa1 (4dxf A:7-99)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381771Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2382641Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2382642Protein automated matches [226834] (5 species)
    not a true protein
  7. 2382670Species Staphylococcus aureus [TaxId:93061] [226094] (7 PDB entries)
  8. 2382671Domain d4dxfa1: 4dxf A:7-99 [266160]
    Other proteins in same PDB: d4dxfa2, d4dxfb2
    automated match to d4rcob1
    complexed with cl, gol

Details for d4dxfa1

PDB Entry: 4dxf (more details), 1.7 Å

PDB Description: Crystal structure of Staphylococcal Superantigen-Like protein 4
PDB Compounds: (A:) Staphylococcal enterotoxin-like toxin

SCOPe Domain Sequences for d4dxfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dxfa1 b.40.2.0 (A:7-99) automated matches {Staphylococcus aureus [TaxId: 93061]}
einpkfkdlrayytkpslefkneigiilkkwttirfmnvvpdyfiykialvgkddkkyge
gvhrnvdvfvvleennynlekysvggitksnsk

SCOPe Domain Coordinates for d4dxfa1:

Click to download the PDB-style file with coordinates for d4dxfa1.
(The format of our PDB-style files is described here.)

Timeline for d4dxfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dxfa2