Lineage for d4dm6b_ (4dm6 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012723Protein Retinoic acid receptor beta (RAR-beta) [117011] (2 species)
  7. 2012724Species Human (Homo sapiens) [TaxId:9606] [117013] (2 PDB entries)
    Uniprot P10826 182-416
  8. 2012726Domain d4dm6b_: 4dm6 B: [266158]
    Other proteins in same PDB: d4dm6a2
    complexed with ttb

Details for d4dm6b_

PDB Entry: 4dm6 (more details), 1.9 Å

PDB Description: Crystal structure of RARb LBD homodimer in complex with TTNPB
PDB Compounds: (B:) Retinoic acid receptor beta

SCOPe Domain Sequences for d4dm6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dm6b_ a.123.1.1 (B:) Retinoic acid receptor beta (RAR-beta) {Human (Homo sapiens) [TaxId: 9606]}
yemtaelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkcii
kivefakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqm
hnagfgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqeplle
alkiyirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlen

SCOPe Domain Coordinates for d4dm6b_:

Click to download the PDB-style file with coordinates for d4dm6b_.
(The format of our PDB-style files is described here.)

Timeline for d4dm6b_: