SCOPe 2.06: Domain d4d08a_: 4d08 A:

Lineage for d4d08a_ (4d08 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)

8. Domain d4d08a_: 4d08 A: [266135]
   automated match to d4d09c_
   complexed with mg, q2t, zn

Details for d4d08a_

PDB Entry: 4d08, 1.9 Å

PDB Description: PDE2a catalytic domain in complex with a brain penetrant inhibitor

PDB Compounds: (A:) cgmp-dependent 3', 5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d4d08a_:

Sequence; same for both SEQRES and ATOM records:

>d4d08a_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfld

Timeline for d4d08a_:

• d4d08a_ first appeared in SCOPe 2.05
  
• d4d08a_ appears in SCOPe 2.07
  
• d4d08a_ appears in the current release, SCOPe 2.08