Lineage for d4cztc_ (4czt C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2223673Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (25 PDB entries)
  8. 2223695Domain d4cztc_: 4czt C: [266134]
    Other proteins in same PDB: d4czta2, d4cztb2, d4cztd2
    automated match to d4czuc_
    complexed with cps, so4

Details for d4cztc_

PDB Entry: 4czt (more details), 2.3 Å

PDB Description: crystal structure of the kinase domain of cipk23
PDB Compounds: (C:) cbl-interacting serine/threonine-protein kinase 23

SCOPe Domain Sequences for d4cztc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cztc_ d.144.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vgkyelgrtlgegtfakvkfarnvengdnvaikvidkekvlknkmiaqikreistmklik
hpnvirmfevmasktkiyfvlefvtggelfdkissngrlkedearkyfqqlinavdychs
rgvyhrdlkpenllldangalkvsdfglsalpqqvredgllhttcgtpnyvapevinnkg
ydgakadlwscgvilfvlmagylpfedsnltslykkifkaeftcppwfsasakklikril
dpnpatritfaevienewfkkgykapkfenadvslddvdaifddsg

SCOPe Domain Coordinates for d4cztc_:

Click to download the PDB-style file with coordinates for d4cztc_.
(The format of our PDB-style files is described here.)

Timeline for d4cztc_: