SCOPe 2.08: Domain d4czka1: 4czk A:9-149

Lineage for d4czka1 (4czk A:9-149)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Caulobacter vibrioides [TaxId:155892] [256751] (9 PDB entries)

8. Domain d4czka1: 4czk A:9-149 [266130]
   automated match to d4czfa1
   complexed with anp, f90, mg

Details for d4czka1

PDB Entry: 4czk, 2.6 Å

PDB Description: C. crescentus MreB, single filament, AMPPNP, MP265 inhibitor

PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d4czka1:

Sequence, based on SEQRES records:

>d4czka1 c.55.1.0 (A:9-149) automated matches {Caulobacter vibrioides [TaxId: 155892]}
isndiaidlgtantliyqkgkgivlnepsvvalrnvggrkvvhavgieakqmlgrtpghm
eairpmrdgviadfevaeemikyfirkvhnrkgsgnpkvivcvpsgataverraindscl
nagarrvglidepmaaaigag

Sequence, based on observed residues (ATOM records):

>d4czka1 c.55.1.0 (A:9-149) automated matches {Caulobacter vibrioides [TaxId: 155892]}
isndiaidlgtantliyqkgkgivlnepsvvalrnkvvhavgieakqmlgrtpghmeair
pmrdgviadfevaeemikyfirkvhnrkgsgnpkvivcvpsgataverraindsclnaga
rrvglidepmaaaigag

Timeline for d4czka1:

• d4czka1 first appeared in SCOPe 2.05
  
• d4czka1 appears in SCOPe 2.07