Lineage for d4cz6d_ (4cz6 D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737237Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 1737238Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 1737288Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 1737289Protein automated matches [259190] (1 species)
    not a true protein
  7. 1737290Species Zebrafish (Danio rerio) [TaxId:7955] [259192] (5 PDB entries)
  8. 1737304Domain d4cz6d_: 4cz6 D: [266119]
    automated match to d4cz7b_
    complexed with peg

Details for d4cz6d_

PDB Entry: 4cz6 (more details), 1.53 Å

PDB Description: truncated tetramerization domain of zebrafish p53 (crystal form ii)
PDB Compounds: (D:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4cz6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cz6d_ a.53.1.0 (D:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ggseeiftlqvrgreryeilkklndslelsdvv

SCOPe Domain Coordinates for d4cz6d_:

Click to download the PDB-style file with coordinates for d4cz6d_.
(The format of our PDB-style files is described here.)

Timeline for d4cz6d_: