![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
![]() | Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) ![]() homotetramer |
![]() | Family a.53.1.0: automated matches [259188] (1 protein) not a true family |
![]() | Protein automated matches [259190] (1 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [259192] (5 PDB entries) |
![]() | Domain d4cz6d_: 4cz6 D: [266119] automated match to d4cz7b_ complexed with peg |
PDB Entry: 4cz6 (more details), 1.53 Å
SCOPe Domain Sequences for d4cz6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cz6d_ a.53.1.0 (D:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} ggseeiftlqvrgreryeilkklndslelsdvv
Timeline for d4cz6d_: