Lineage for d4cz5c1 (4cz5 C:302-331)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323790Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2323791Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2323852Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 2323853Protein automated matches [259190] (2 species)
    not a true protein
  7. 2323888Species Zebrafish (Danio rerio) [TaxId:7955] [259192] (5 PDB entries)
  8. 2323891Domain d4cz5c1: 4cz5 C:302-331 [266114]
    Other proteins in same PDB: d4cz5c2
    automated match to d4cz7b_

Details for d4cz5c1

PDB Entry: 4cz5 (more details), 1.02 Å

PDB Description: Truncated tetramerization domain of zebrafish p53 (crystal form I)
PDB Compounds: (C:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4cz5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cz5c1 a.53.1.0 (C:302-331) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
eeiftlqvrgreryeilkklndslelsdvv

SCOPe Domain Coordinates for d4cz5c1:

Click to download the PDB-style file with coordinates for d4cz5c1.
(The format of our PDB-style files is described here.)

Timeline for d4cz5c1: