![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily) multihelical |
![]() | Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) ![]() duplication: all chain but the N-terminal helix forms two structural repeats |
![]() | Family a.124.1.0: automated matches [194368] (1 protein) not a true family |
![]() | Protein automated matches [194369] (2 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196872] (5 PDB entries) |
![]() | Domain d4cxva_: 4cxv A: [266110] automated match to d4cwma_ protein/DNA complex; complexed with nag, po4, zn |
PDB Entry: 4cxv (more details), 2 Å
SCOPe Domain Sequences for d4cxva_:
Sequence, based on SEQRES records: (download)
>d4cxva_ a.124.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} wgkegheiickiaqtrldetaakavkellpesaegdlsslclwadrvkfryhwssplhyi ntpdacsyqynrdckdesgekgrcvagaiynyttqllsyktaassqsqynlteallfvsh fmgdihqplhvsyasdkggntievhwytrkanlhhiwdsniietaeadlynsalegmvda lkknittewadqvkrwetctkktacpdiyasegiqaacdwaykgvtegdtledeyfysrl pivyqrlaqggvrlaatlnrifgh
>d4cxva_ a.124.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} wgkegheiickiaqtrldetaakavkellpesaegdlsslclwadrvkfryhwssplhyi ntpdacsyqynrdckdesgekgrcvagaiynyttqllsyktaaqynlteallfvshfmgd ihqplhvsyasdkggntievhwytrkanlhhiwdsniietaeadlynsalegmvdalkkn ittewadqvkrwetctktacpdiyasegiqaacdwaykgvtegdtledeyfysrlpivyq rlaqggvrlaatlnrifgh
Timeline for d4cxva_: