Lineage for d4cxpa1 (4cxp A:1-263)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009738Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2009739Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2009774Family a.124.1.0: automated matches [194368] (1 protein)
    not a true family
  6. 2009775Protein automated matches [194369] (3 species)
    not a true protein
  7. 2009781Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196872] (5 PDB entries)
  8. 2009782Domain d4cxpa1: 4cxp A:1-263 [266106]
    Other proteins in same PDB: d4cxpa2
    automated match to d4cwma_
    protein/DNA complex; complexed with 1pe, so4, zn

Details for d4cxpa1

PDB Entry: 4cxp (more details), 1.22 Å

PDB Description: Structure of bifunctional endonuclease (AtBFN2) from Arabidopsis thaliana in complex with sulfate
PDB Compounds: (A:) Endonuclease 2

SCOPe Domain Sequences for d4cxpa1:

Sequence, based on SEQRES records: (download)

>d4cxpa1 a.124.1.0 (A:1-263) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
wgkegheiickiaqtrldetaakavkellpesaegdlsslclwadrvkfryhwssplhyi
ntpdacsyqynrdckdesgekgrcvagaiynyttqllsyktaassqsqynlteallfvsh
fmgdihqplhvsyasdkggntievhwytrkanlhhiwdsniietaeadlynsalegmvda
lkknittewadqvkrwetctkktacpdiyasegiqaacdwaykgvtegdtledeyfysrl
pivyqrlaqggvrlaatlnrifg

Sequence, based on observed residues (ATOM records): (download)

>d4cxpa1 a.124.1.0 (A:1-263) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
wgkegheiickiaqtrldetaakavkellpesaegdlsslclwadrvkfryhwssplhyi
ntpdacsyqynrdckdesgekgrcvagaiynyttqllsyksqynlteallfvshfmgdih
qplhvsyasdkggntievhwytrkanlhhiwdsniietaeadlynsalegmvdalkknit
tewadqvkrwetctktacpdiyasegiqaacdwaykgvtegdtledeyfysrlpivyqrl
aqggvrlaatlnrifg

SCOPe Domain Coordinates for d4cxpa1:

Click to download the PDB-style file with coordinates for d4cxpa1.
(The format of our PDB-style files is described here.)

Timeline for d4cxpa1:

  • d4cxpa1 first appeared in SCOPe 2.05, called d4cxpa_

View in 3D
Domains from same chain:
(mouse over for more information)
d4cxpa2