SCOPe 2.06: Domain d4ct5b2: 4ct5 B:302-469

Lineage for d4ct5b2 (4ct5 B:302-469)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)

8. Domain d4ct5b2: 4ct5 B:302-469 [266083]
   automated match to d4ct4b2
   complexed with act

Details for d4ct5b2

PDB Entry: 4ct5, 3 Å

PDB Description: ddx6

PDB Compounds: (B:) ddx6

SCOPe Domain Sequences for d4ct5b2:

Sequence; same for both SEQRES and ATOM records:

>d4ct5b2 c.37.1.0 (B:302-469) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeltlkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgysc
fyihakmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhr
igrsgrfghlglainlityddrfnlksieeqlgteikpipsnidksly

Timeline for d4ct5b2:

• d4ct5b2 first appeared in SCOPe 2.05
  
• d4ct5b2 appears in SCOPe 2.07
  
• d4ct5b2 appears in the current release, SCOPe 2.08