SCOP 1.73: Domain d4phvb_: 4phv B:

Lineage for d4phvb_ (4phv B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries)

8. Domain d4phvb_: 4phv B: [26608]
   complexed with vac

Details for d4phvb_

PDB Entry: 4phv, 2.1 Å

PDB Description: x-ray crystal structure of the hiv protease complex with l-700,417, an inhibitor with pseudo c2 symmetry

PDB Compounds: (B:) hiv-1 protease

SCOP Domain Sequences for d4phvb_:

Sequence; same for both SEQRES and ATOM records:

>d4phvb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d4phvb_:

• d4phvb_ first appeared (with stable ids) in SCOP 1.55
  
• d4phvb_ appears in SCOP 1.71
  
• d4phvb_ appears in SCOP 1.75
  
• d4phvb_ appears in the current release, SCOPe 2.08