Lineage for d4csza1 (4csz A:2-159)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2044511Protein automated matches [226877] (4 species)
    not a true protein
  7. 2044514Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries)
  8. 2044545Domain d4csza1: 4csz A:2-159 [266078]
    automated match to d1gs7a1
    complexed with cu, no2, peg, zn; mutant

Details for d4csza1

PDB Entry: 4csz (more details), 1.75 Å

PDB Description: structure of f306c mutant of nitrite reductase from achromobacter xylosoxidans with nitrite bound
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d4csza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4csza1 b.6.1.3 (A:2-159) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

SCOPe Domain Coordinates for d4csza1:

Click to download the PDB-style file with coordinates for d4csza1.
(The format of our PDB-style files is described here.)

Timeline for d4csza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4csza2