Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [256202] (5 PDB entries) |
Domain d4cqyd_: 4cqy D: [266075] Other proteins in same PDB: d4cqya1, d4cqya2, d4cqyc1, d4cqyc2, d4cqye1, d4cqye2 automated match to d2fk0b1 complexed with nag, po4; mutant |
PDB Entry: 4cqy (more details), 2.05 Å
SCOPe Domain Sequences for d4cqyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqyd_ h.3.1.1 (D:) automated matches {Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqys
Timeline for d4cqyd_: