Lineage for d4cqxe1 (4cqx E:1-320)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2370862Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2371293Protein automated matches [190291] (18 species)
    not a true protein
  7. 2371342Species Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [193032] (5 PDB entries)
  8. 2371351Domain d4cqxe1: 4cqx E:1-320 [266070]
    Other proteins in same PDB: d4cqxa2, d4cqxb_, d4cqxd_, d4cqxe2, d4cqxf_
    automated match to d1rd8a_
    complexed with nag, po4; mutant

Details for d4cqxe1

PDB Entry: 4cqx (more details), 2.3 Å

PDB Description: H5 (tyTy) Del133/Ile155Thr Mutant Haemagglutinin in Complex with Human Receptor Analogue 6'SLN
PDB Compounds: (E:) haemagglutinin ha1

SCOPe Domain Sequences for d4cqxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqxe1 b.19.1.2 (E:1-320) automated matches {Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks
swsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp
ndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndainf
esngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltige
cpkyvkssrlvlatglrnsp

SCOPe Domain Coordinates for d4cqxe1:

Click to download the PDB-style file with coordinates for d4cqxe1.
(The format of our PDB-style files is described here.)

Timeline for d4cqxe1: