Lineage for d4cqxd_ (4cqx D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041535Species Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [256202] (5 PDB entries)
  8. 3041543Domain d4cqxd_: 4cqx D: [266069]
    Other proteins in same PDB: d4cqxa1, d4cqxa2, d4cqxc_, d4cqxe1, d4cqxe2
    automated match to d2fk0b1
    complexed with nag, po4; mutant

Details for d4cqxd_

PDB Entry: 4cqx (more details), 2.3 Å

PDB Description: h5 (tyty) del133/ile155thr mutant haemagglutinin in complex with human receptor analogue 6'sln
PDB Compounds: (D:) haemagglutinin ha2

SCOPe Domain Sequences for d4cqxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqxd_ h.3.1.1 (D:) automated matches {Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqys

SCOPe Domain Coordinates for d4cqxd_:

Click to download the PDB-style file with coordinates for d4cqxd_.
(The format of our PDB-style files is described here.)

Timeline for d4cqxd_: