SCOPe 2.05: Domain d4cqxc_: 4cqx C:

Lineage for d4cqxc_ (4cqx C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [256675] (4 PDB entries)

8. Domain d4cqxc_: 4cqx C: [266068]
   Other proteins in same PDB: d4cqxb_, d4cqxd_, d4cqxf_
   automated match to d1rd8a_
   complexed with nag, po4; mutant

Details for d4cqxc_

PDB Entry: 4cqx, 2.3 Å

PDB Description: h5 (tyty) del133/ile155thr mutant haemagglutinin in complex with human receptor analogue 6'sln

PDB Compounds: (C:) haemagglutinin ha1

SCOPe Domain Sequences for d4cqxc_:

Sequence; same for both SEQRES and ATOM records:

>d4cqxc_ b.19.1.2 (C:) automated matches {Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks
swsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp
ndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndainf
esngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltige
cpkyvkssrlvlatglrnsp

Timeline for d4cqxc_:

• d4cqxc_ is new in SCOPe 2.05-stable
  
• d4cqxc_ appears in SCOPe 2.06
  
• d4cqxc_ appears in the current release, SCOPe 2.08