Lineage for d4cqxc_ (4cqx C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776084Species Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [193032] (5 PDB entries)
  8. 2776092Domain d4cqxc_: 4cqx C: [266068]
    Other proteins in same PDB: d4cqxa2, d4cqxb_, d4cqxd_, d4cqxe2, d4cqxf_
    automated match to d1rd8a_
    complexed with nag, po4; mutant

Details for d4cqxc_

PDB Entry: 4cqx (more details), 2.3 Å

PDB Description: h5 (tyty) del133/ile155thr mutant haemagglutinin in complex with human receptor analogue 6'sln
PDB Compounds: (C:) haemagglutinin ha1

SCOPe Domain Sequences for d4cqxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqxc_ b.19.1.2 (C:) automated matches {Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks
swsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp
ndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndainf
esngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltige
cpkyvkssrlvlatglrnsp

SCOPe Domain Coordinates for d4cqxc_:

Click to download the PDB-style file with coordinates for d4cqxc_.
(The format of our PDB-style files is described here.)

Timeline for d4cqxc_: