![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (19 species) not a true protein |
![]() | Species Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [193032] (5 PDB entries) |
![]() | Domain d4cqxc_: 4cqx C: [266068] Other proteins in same PDB: d4cqxa2, d4cqxb_, d4cqxd_, d4cqxe2, d4cqxf_ automated match to d1rd8a_ complexed with nag, po4; mutant |
PDB Entry: 4cqx (more details), 2.3 Å
SCOPe Domain Sequences for d4cqxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqxc_ b.19.1.2 (C:) automated matches {Influenza A virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks swsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp ndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndainf esngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltige cpkyvkssrlvlatglrnsp
Timeline for d4cqxc_: